PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0532s0070.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family GRF
Protein Properties Length: 456aa    MW: 49993.1 Da    PI: 8.7948
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0532s0070.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC79.62.9e-25106150145
                     WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                             d+epgrCrRtDGKkWRCs++v++g+k+CErH+hrgr+rsrk +e+
  SapurV1A.0532s0070.2.p 106 DPEPGRCRRTDGKKWRCSKDVVAGQKYCERHMHRGRQRSRKLVEA 150
                             79****************************************997 PP

2WRC62.56.4e-20335371339
                     WRC   3 epgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrs 39 
                             e grCrRtDGKkWRC+r+v++++k+CE H+hrg+++ 
  SapurV1A.0532s0070.2.p 335 ELGRCRRTDGKKWRCRRNVVANQKYCEMHMHRGSKQH 371
                             679******************************7765 PP

3QLQ491.9e-173569337
                     QLQ  3 FTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                            +T +Ql++Lk+Q+l++Ky++a++PvP +L+++i++
  SapurV1A.0532s0070.2.p 35 LTETQLHELKQQALIFKYIVAGLPVPLDLVVPIWH 69
                            79*******************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.7E-83369IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166619.7973469IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.8E-123668IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.356106150IPR014977WRC domain
PfamPF088791.6E-21107149IPR014977WRC domain
PROSITE profilePS5166719.854333379IPR014977WRC domain
PfamPF088792.1E-16336372IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 456 aa     Download sequence    Send to blast
MEERLSEESA PSMKLSLGIG AGYLDDDDRH VFPQLTETQL HELKQQALIF KYIVAGLPVP  60
LDLVVPIWHS VASSSLVSFS GADIYRQIPS FVGLSPQGFD YRQMMDPEPG RCRRTDGKKW  120
RCSKDVVAGQ KYCERHMHRG RQRSRKLVEA SQTAADSEKS SPHNSNKNSD KPNSHPSSLA  180
PITSQIKAPP LDNTFTTLAT CTTSSSSDIE ITGMSLTTAA NADSKNPFTT VTTSIVTGYK  240
NTATMIGSAV HADITATGND YRSSINLKRH YIDDRNSNCS NSVTCEGIIH RSCNNKKIKN  300
AGSKICQGLN FSPKSVLQVQ GCGASHNYIN DVELELGRCR RTDGKKWRCR RNVVANQKYC  360
EMHMHRGSKQ HMEASKPAAI LATIPVVPES FHSHPTTTLP SKADYRSLNT DLCISIPTSA  420
KLITTNDDTR TTSNSSDTTI SDTMVGAYQN KNLSS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011034630.10.0PREDICTED: growth-regulating factor 9
RefseqXP_011034638.10.0PREDICTED: growth-regulating factor 9
TrEMBLB9IC190.0B9IC19_POPTR; Uncharacterized protein
STRINGPOPTR_0014s06750.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36400.11e-31growth-regulating factor 3